Skip to Content
-
Sort By: Featured
Serratedsize:End Tweezer
167.00 € 167.0 EUR
Serotonin Rabbit Polyclonal Antibody size: 50 µL
520.00 € 520.0 EUR
Serotonin Rabbit Polyclonal Antibody size: 50 µL
520.00 € 520.0 EUR
Serotonin ELISA kit Ultrasize:Sensitive – Any sample size: 96 Tests
770.00 € 770.0 EUR
SeroDetect HBsAg Verification Panel
850.00 € 850.0 EUR
SeroDetect Antisize:HCV Verification Panel 5 X 1.5 mL
635.00 € 635.0 EUR
Seringue 1ml Injekt®size:F solo 2 pièces sans volume mort graduation 0.01ml emballage individuel stérile 1 * 100 Pce
60.00 € 60.0 EUR
Seringue 1ml 2size:pièces luer slip, non stérile conditionnée par sachet de 100, en salle propre classe 100.000 1 * 100 Pce
60.00 € 60.0 EUR
Serine protease splD splD Recombinant Protein, 1000 UG
2,065.50 € 2065.5 EUR
Seraseq® ctDNA Mutation Mix v2 AF0.5%
1,651.00 € 1651.0 EUR
Seraseq® ctDNA Complete Mutation Mix AF 2.5%
1,855.00 € 1855.0 EUR
Seraseq TNA DNA/RNA WT Mix NEW
1,418.00 € 1418.0 EUR
Seraseq Myeloid RNA Fusion Mix size: 1 x 25 µL
3,450.00 € 3450.0 EUR
Seraseq Myeloid Mutation DNA m size: 1 x 25 µL
3,450.00 € 3450.0 EUR
Seraseq FFPE Tumor Mutational Burden TMB
1,926.00 € 1926.0 EUR
Seraseq Compromised FFPE WT DNA/RNA Reference
567.00 € 567.0 EUR
Seraseq Compromised FFPE Tumor DNA Reference
1,587.00 € 1587.0 EUR
Serafol ABO+D size: 50 Test Cards
90.00 € 90.0 EUR
Serafol AB0+D Bedside Test size: 50 piece
225.00 € 225.0 EUR
SeraMir Exosome RNA Purification kit 5ml ExoQuick and 20 exoRNA columns size: 20 preps
770.00 € 770.0 EUR
SeraMir Exosome RNA Purification Column kit 20 exoRNA columns size: 20 preps
610.00 € 610.0 EUR
SeraMir Exosome RNA Ampflication Kit size: 20 reactions
1,250.00 € 1250.0 EUR
SequaGel UreaGel 19:1 Concentrate size: 1L
533.00 € 533.0 EUR
Sephadex Gsize:15 100g
630.00 € 630.0 EUR
Separating Funnel, Cylindrical Open Top, Glass Stopcock, Borosilicate Glass SIMAX size: 500 mL x 1 Pack
285.00 € 285.0 EUR
SensoLyte® Transglutaminase Activity Assay Kit Colorimetric size: 1 kit
1,070.00 € 1070.0 EUR
Sensitive tissue hydroxyproline kit 5x 96size:assays bulk pack
2,107.00 € 2107.0 EUR
Sensitive tissue collagen assay kit 96size:assays
577.00 € 577.0 EUR
SensiFAST SYBR® & Fluorescein Kit size: 1000 x 20µL
2,100.00 € 2100.0 EUR
SensPERT Rotavirus Ag Test size: 10 tests
120.50 € 120.5 EUR
SensPERT Rabies Ag Test size: 10 tests
125.50 € 125.5 EUR
SensPERT Lyme Ab Test size: 10 Tests
113.00 € 113.0 EUR
SensPERT Leptospira IgM Ab Test size: 10 tests
116.50 € 116.5 EUR
SensPERT Leptospira IgM / IgM Ab Test size: 10 tests
145.70 € 145.7 EUR
SensPERT Leishmania Ab Test size: 10 Tests
111.00 € 111.0 EUR
SensPERT Giardia Ag Test size: 10 Tests
113.00 € 113.0 EUR
SensPERT Foal IgG Test size: 10 tests
95.50 € 95.5 EUR
SensPERT Feline Toxo IgG Ab / IgM Ab combo Test size: 10 Tests
136.00 € 136.0 EUR
SensPERT FeLV Ag Test size: 10 Tests
108.50 € 108.5 EUR
SensPERT FeLV Ag / FIV Ab combo Test size: 10 Tests
120.70 € 120.7 EUR
SensPERT FPV Ag Test size: 10 Tests
103.00 € 103.0 EUR
SensPERT FIV Ab Test size: 10 Tests
110.50 € 110.5 EUR
SensPERT FIP FCoV Ab Test size: 10 Tests
111.00 € 111.0 EUR
SensPERT Ehrlichia Ab Test size: 10 Tests
117.00 € 117.0 EUR
SensPERT Canine Total IgE Test size: 10 tests
112.50 € 112.5 EUR
SensPERT CPV Ag Test size: 10 Tests
100.50 € 100.5 EUR
SensPERT CPV Ag / GIA Ag combo Test size:10 tests
128.70 € 128.7 EUR
SensPERT CHW Ag / Anaplasma Ab / E. canis Ab / Lyme Ab quatro Test SensPERT Lymesize: Quatro Test size: 10 tests
135.70 € 135.7 EUR
SensPERT CHW Ag / Anaplasma Ab / E. canis Ab / LSH Ab quatro Test SensPERT LSHsize:Quatro Test size: 10 tests
135.70 € 135.7 EUR
SensPERT CDV Ag Test size: 10 Tests
100.50 € 100.5 EUR
SensPERT CCV Ag Test size: 10 Tests
110.50 € 110.5 EUR
SensPERT CCV Ag / CPV Ag combo Test size: 10 Tests
120.70 € 120.7 EUR
SensPERT CCV Ag / CPV Ag / GIA Ag triple Test size: 10 tests
140.70 € 140.7 EUR
SensPERT CAV Ag TestSensPERT CAV Ag Test size: 10 tests
118.50 € 118.5 EUR
SensPERT CAV Ag / CDV Ag combo Test size: 10 tests
127.70 € 127.7 EUR
SensPERT Brucella Ab Test size: 10tests
117.50 € 117.5 EUR
SensPERT Babesia size: 10 Tests
117.00 € 117.0 EUR
SensPERT Anaplasma Ab Test size: 10tests
120.50 € 120.5 EUR
SensPERT Ana Ab / E. canis Ab combo Test size: 10 tests
140.70 € 140.7 EUR
Senescence βsize:Galactosidase Staining Kit
560.00 € 560.0 EUR
Sendai virus endpoint size: 96 Reactions
470.00 € 470.0 EUR
Sendai virus endpoint size: 48 Reactions
365.00 € 365.0 EUR
Semaglutide
3,300.00 € 3300.0 EUR
Selfsize:Laminating Vinyl Wrap Around Labels with Ribbon for BMP41 BMP51 M511 Printers size: 1" x 1", White
208.78 € 208.78 EUR
Selenium Microplate Assay Kit
621.88 € 621.88 EUR
Selenium Assay Kit size: 100 Assays
750.00 € 750.0 EUR
Selenite Broth Base size: 500 g
216.86 € 216.86 EUR
SeleCTEV DNA Enrichment Kit
699.00 € 699.0 EUR
Sectm1a untagged size: Mouse secreted and transmembrane 1A Sectm1a , 10ug
382.50 € 382.5 EUR
Sectm1a GFPsize:tagged size: Mouse secreted and transmembrane 1A Sectm1a , 10ug
830.00 € 830.0 EUR
Section incubation carrier kit for 6 wells Dimensions 8 × 7 × 7 in
173.00 € 173.0 EUR
Section incubation carrier kit for 12 wells Dimensions 8 × 7 × 7 in
173.00 € 173.0 EUR
Secondary alcohol polyoxyethylene ether CAS No. : 84133size:50size:6 98% size: 100 mg
482.50 € 482.5 EUR
Scrub Typhus IgG/IgM Rapid Test Cassette size: 10 T
243.00 € 243.0 EUR
Screen It CRISPR Cas9 Cleavage Detection Kit size: 100 Reactions
1,302.50 € 1302.5 EUR
Schwann Growth Medium size: 500 mL
440.00 € 440.0 EUR
Scandium Pieces, 99.99% 7440size:20size:2 size: 5g
2,794.00 € 2794.0 EUR
Saturated phenol ± 0.2 pHsize:units for molecular biology size: 400 ml
884.00 € 884.0 EUR
Sarecycline CAS No [1035654size:66size:0] size: 1 mg
146.00 € 146.0 EUR
Sarcosine Assay Kit size: 100 Assays
525.00 € 525.0 EUR
Sarcocystis neurona Endsize:Point PCR size: 48 rxs
441.50 € 441.5 EUR
Saponin Technical Grade CASNo:8047size:15size:2 size: 25g
246.00 € 246.0 EUR
Sample Diluent Buffer, 500 mL
750.00 € 750.0 EUR
Sample Diluent Buffer I028 , 100 ml
737.00 € 737.0 EUR
Sample Collection for C2T 64 pcs
500.00 € 500.0 EUR
Sample Buffer, 440ul
261.00 € 261.0 EUR
Sambucus nigra Lectin size: 1mg
538.00 € 538.0 EUR
Sambucus nigra Lectin SNA/EBL I+II size: Pure size: 2mg
281.00 € 281.0 EUR
Sambucus nigra Lectin SNA/EBL I size: FITC Fluorescein size: 1 mg
469.00 € 469.0 EUR
Salmonella sp. One Step qRT PCRsize:50 rxs
633.65 € 633.65 EUR
Salmonella Typhimurium Control size: Median S2 size: 12 x 0.5mL
350.00 € 350.0 EUR
Salmonella Typhimurium Control size: Low S1 size: 12 x 0.5mL
300.00 € 300.0 EUR
Salmonella Typhimurium Control size: High S3 size: 12 x 0.5mL
400.00 € 400.0 EUR
Salmonella Typhimurium Control size: All Levels size: 18 x 0.5mL
550.00 € 550.0 EUR
Salmonella Rapid Detection Kit, 20 tests
430.00 € 430.0 EUR
Salmonella Antibody, 1mL
645.00 € 645.0 EUR
SalivaBio Infant Swab SIS – 50/pk
288.00 € 288.0 EUR
SalivaBio Children’s Swab SCS 50/pk
309.00 € 309.0 EUR
SaliCap Component Saliva
187.20 € 187.2 EUR
Sales tax 9.50%
0.00 € 0.0 EUR
Sales tax 9.38%
0.00 € 0.0 EUR
Sales tax 9.13%
0.00 € 0.0 EUR
Sales tax 8.63%
0.00 € 0.0 EUR
Sales tax 7.75%
0.00 € 0.0 EUR
Sales Tax
0.00 € 0.0 EUR
Sales TAX 10.25%
0.00 € 0.0 EUR
Safetysize:Needle 20Gx1½" size: 50
290.00 € 290.0 EUR
Safesize:Red, 1.0 mL
71.00 € 71.0 EUR
Safesize:Red Gel
96.00 € 96.0 EUR
Safesize:Green size: 1ml
130.00 € 130.0 EUR
Safe DNA Gel Stainsize:1ml
373.50 € 373.5 EUR
Saccharose, Extra pure, 500 g
98.00 € 98.0 EUR
Saccharomyces bourladii CNCM Isize:745 strain Freezesize:dried powder
1,099.00 € 1099.0 EUR
SaMag Viral Nucleic Acids Extraction kit CE
365.30 € 365.3 EUR
SaMag FFPE Tissue DNA Extraction kit size: 48T
280.00 € 280.0 EUR
SZ3 CAS#: 2556443size:73size:1 , Purity > 98% size: 1 g
14,275.00 € 14275.0 EUR
SYS Mini horizontal unit, 7x7 cm casting tray loading guides, dams 2 combs: 8 sample, 1 mm
384.00 € 384.0 EUR
SV40 Small/Large T Antigen Lentivirus CMV, Puro LVIM001Z size: 100ul，1x10^8TU/ml
4,500.00 € 4500.0 EUR
SV2A elisa kit :: Human synaptic vesicle glycoprotein 2A ELISA Kit size: 96 Wells
1,054.00 € 1054.0 EUR
SUPER PIGGYBAC TRANSPOSASE PB200PAsize: 1 PLASMID
412.00 € 412.0 EUR
SUMO1 Protein, Human His size: 100 µg
375.00 € 375.0 EUR
SUMO Protease 1, Hissize:tag SUMOsize:P1 His size: 10 mg
378.00 € 378.0 EUR
SUMO Protease 1, GSTsize:tag SUMOsize:P1 GST size:10 mg
378.00 € 378.0 EUR
SULF2 elisa kit :: Porcine Sulfatase 2 ELISA Kit size: 96size:Stripsize:Wells
1,139.00 € 1139.0 EUR
SULF2 elisa kit :: Human Sulfatase 2 SULF2 ELISA Kit size: 96 tests
935.00 € 935.0 EUR
STROMATOLYSERsize:WH 3X500 mL
596.51 € 596.51 EUR
STREP A F 25T_GLOBAL size: 25 Tests
160.00 € 160.0 EUR
STMN2 elisa kit :: Human Stathmin 2 STMN2 ELISA Kit size: 96Wells
1,054.00 € 1054.0 EUR
STMN2 elisa kit :: Human Stathmin 2 STMN2 ELISA Kit size: 48 Wells
761.60 € 761.6 EUR
STAT3 sgRNA CRISPR/Cas9 Allsize:insize:One Lentivector set Human
400.00 € 400.0 EUR
STAT3 Rabbit pAb, 20 µL
250.00 € 250.0 EUR
STANDARD Q Strep A Ag size: 25T/kit
325.00 € 325.0 EUR
STANDARD F CRP size: 20T/kit
260.00 € 260.0 EUR
STANDARD ZERO CORTICOSTERONE ELISA 50ML
569.00 € 569.0 EUR
STANDARD F S. Pneumoniae Ag FIA 25 tests
275.00 € 275.0 EUR
STAINperfect immunostaining kit A size: 1 Kit
400.00 € 400.0 EUR
SS Beads 0.9 size: 2.0mm size: Stainless steel beads. 0.9 size: 2.0mm. 1 lb. Nonsize:sterile.
460.00 € 460.0 EUR
SS Beads 0.2mm size: Stainless steel beads. 0.2mm. 1 lb. Nonsize:sterile.
335.00 € 335.0 EUR
SPY555size:FastAct Spirochrome size: 100 stainings
725.00 € 725.0 EUR
SPY505size:DNA Probe, 100 slides
779.00 € 779.0 EUR
SPS | Sucrose phosphate synthase maize size: 50 µg
550.00 € 550.0 EUR
SPRR1B elisa kit :: Human Cornifinsize:B SPRR1B ELISA Kit size: 96 Tests
694.00 € 694.0 EUR
SPHERO Streptavidin Coated Particles size: 0.5% w/v 14.0size:17.9 µmsize: 4mL
554.00 € 554.0 EUR
SPF450 Filter 450 ±10 nm + Y52 Filter 520.00 ±5 nm for Kronos HT
3,240.00 € 3240.0 EUR
SPARC Antibody size: 100µL
452.00 € 452.0 EUR
SPAM1 elisa kit :: Human Hyaluronidase PHsize:20, SPAM1 ELISA Kit size: 96size:Stripsize:Wells
487.20 € 487.2 EUR
SPAM1 elisa kit :: Human Hyaluronidase PHsize:20, SPAM1 ELISA Kit size: 5x96size:Stripsize:Wells
2,700.00 € 2700.0 EUR
SPAM1 Polyclonal Antibody
529.00 € 529.0 EUR
SPAM1 Antibody, HRP conj µgated size: 50 µg
466.00 € 466.0 EUR
SPAsize:PEGsize:SPA
429.00 € 429.0 EUR
SP2/0 HCP ELISA Kit, 2G size: 1 kit
1,800.00 € 1800.0 EUR
SPsize:TL Supplement with BSA Fract V , sodium pyruvate, and gentamicin to make SPsize:TALP TLsize:Sperm/Spermsize:Tyrode’s Albumin Lactate Pyruvate ,100 mL
250.00 € 250.0 EUR
SOX9 elisa kit :: Bovine Sex Determining Region Y Box Protein 9 ELISA Kit size: 96size:Stripsize:Wells x 2
2,300.00 € 2300.0 EUR
SOX2, 100 µL
715.00 € 715.0 EUR
SORTASE A PENTAMUTANT ESRTA IN PET29
928.00 € 928.0 EUR
SOD2 elisa kit :: Rat superoxide dismutase 2, mitochondrial ELISA Kit, 96 T
948.00 € 948.0 EUR
SOD assay kit :: Superoxide Dismutases SOD Assay Kit size: 48 Tests
400.00 € 400.0 EUR
SNAP25 elisa kit :: Human Synaptosomal Associated Protein 25kDa ELISA Kit size: 96 Wells
1,054.00 € 1054.0 EUR
SNAP23 Antibody size: 200 µL
520.00 € 520.0 EUR
SNsize:011 2249435size:90size:1 Spec 50 mg
515.00 € 515.0 EUR
SNsize:011 2249435size:90size:1 Spec 100 mg
799.00 € 799.0 EUR
SMYD3 Antibody size: Nsize:terminal region
725.00 € 725.0 EUR
SMT3 Antibody, HRP conj µgated size: 50 µg
533.00 € 533.0 EUR
SMT3 Antibody, HRP conj µgated size: 50 µg
533.00 € 533.0 EUR
SMLA active protein :: super leptin antagonist Active Protein size: 0.1 mg
350.00 € 350.0 EUR
SMIsize:4a size: 10g
246.00 € 246.0 EUR
SMD elisa kit :: Rat Spermidine SMD ELISA Kit size: 96size:Stripsize:Wells
1,170.00 € 1170.0 EUR
SMART BCA Protein Assay Kit size: 2,500 tests
275.00 € 275.0 EUR
SMsize:164 size: 10mM in 1mL DMSO
926.00 € 926.0 EUR
SLPI recombinant protein :: Secretory Leukocyte Peptidase Inhibitor SLPI Recombinant Protein, 1 mg
2,400.00 € 2400.0 EUR
SLH56 — Human IgG Lyophilized >= 97% Purity 10g
2,288.00 € 2288.0 EUR
SLCO1B1 Antibody size: 100 µg
600.00 € 600.0 EUR
SLC39A13 elisa kit :: Human Zinc transporter ZIP13 SLC39A13 ELISA Kit size: 96size:Stripsize:Wells
1,100.00 € 1100.0 EUR
SIRT2 elisa kit :: Human SIRT2 NADsize:dependent protein deacetylase sirtuinsize:2 ELISA Kitsize:96size:Stripsize:Wells
630.00 € 630.0 EUR
SIRT1 elisa kit :: Mouse Sirtuin 1 SIRT1 ELISA Kit size: 96size:Stripsize:Wells
1,010.00 € 1010.0 EUR
SIRT1 elisa kit :: Human Sirtuin 1 SIRT1 ELISA Kit, 48 T
465.00 € 465.0 EUR
SIN3A Lentiviral Vector Human EF1a pLentisize:GIIIsize:EF1a
576.00 € 576.0 EUR
SILICONE VESSEL ID LOOPS White size: W5.00mm/T1.3mm/L450mm size: 960 pcs
1,292.00 € 1292.0 EUR
SILICONE VESSEL ID LOOPS White size: W2.5mm/T1.0mm/L450mm size: 960 pcs
1,292.00 € 1292.0 EUR
SILICONE VESSEL ID LOOPS White size: W1.3mm/T0.9mm/L450mm size: 960 pcs
1,292.00 € 1292.0 EUR
SILICONE VESSEL ID LOOPS White size: W0.5mm/T0.3mm/L450mm size: 960 pcs
1,292.00 € 1292.0 EUR
SILICONE VESSEL ID LOOPS size: W2.5mm/T1.00mm/L450mm color mixed package size: 480 pcs
1,364.00 € 1364.0 EUR
SILAC size: DMEM/F12 size: 500 mL
208.60 € 208.6 EUR
SIAT1 Stable Expressing MDCK MDCKsize:SIAT1 Cell Line size: 1x10⁶cells / 1.0mL
1,219.00 € 1219.0 EUR
SHBG protein ‐ 1 mg
1,727.00 € 1727.0 EUR
SHBG elisa kit :: Horse Sex hormonesize:binding globulin, SHBG ELISA Kit size: 96size:Stripsize:Wells x 3 szt
2,600.00 € 2600.0 EUR
SHsize:Sy5y cells size: 1 vial
967.00 € 967.0 EUR
SHsize:PEG4size:COOH size: Purity: ≥95% CAS NO.: 749247size:06size:1 size: M.W. size: 282.4
850.00 € 850.0 EUR
SHsize:PEGsize:SH – 3.4K M.W. size: 1g
390.00 € 390.0 EUR
SHsize:PEGsize:OH,2K size: 1g
431.00 € 431.0 EUR
SHsize:PEGsize:NH2 from Biopharma PEG, Catalog ID 10084, MW 600,1 gram
700.00 € 700.0 EUR
SHsize:PEGsize:HZ, 6K, 1G
596.00 € 596.0 EUR
SHsize:PEGsize:HZ, 3.4K 1g Purity: ≥95%
596.00 € 596.0 EUR
SHsize:PEGsize:COOH, 2K size: 1g
558.00 € 558.0 EUR
SHsize:PEGsize:Biotin, 1K, 1 g
647.00 € 647.0 EUR
SHsize:HA Hydrogel Kit, 7.5 mL
1,368.00 € 1368.0 EUR
SGPVI elisa kit :: Mouse Soluble Glycoprotein VI SGPVI ELISA Kit, 96 tests
1,075.00 € 1075.0 EUR
SGsize:PEGsize:SG,3.4K, 5g
580.00 € 580.0 EUR
SGsize:PEGsize:SG,3.4K, 1g
370.00 € 370.0 EUR
SFTY PADLOCK STEEL 38MM SHA YELLOW 6/PAC
196.08 € 196.08 EUR
SFsize:295 Cells size: 500,000 Cells
1,196.00 € 1196.0 EUR
SERPINA3 elisa kit :: Human Alphasize:1size:antichymotrypsin ELISA Kit size: 96 Tests
920.00 € 920.0 EUR
SERPINA1 elisa kit :: Pig Alphasize:1size:antitrypsin ELISA Kit size: 96 Wells
803.00 € 803.0 EUR
SERPINA1 elisa kit :: Human Alphasize:1size:antitrypsin ELISA Kit size: 96 Wells
700.00 € 700.0 EUR
SENSISpec Spike Solution Tropomyosin Molluscs 10 ppm
323.00 € 323.0 EUR
SENSISpec Spike Solution Tropomyosin Crustaceans 10 ppm
323.00 € 323.0 EUR
SENSISpec Spike Solution Soy size: Allergen Spike Solutions size: Allergens
282.00 € 282.0 EUR
SENSISpec Spike Solution Sesame size: Allergen Spike Solutions 1000 ppm size: Allergens
282.00 € 282.0 EUR
SENSISpec Spike Solution Peanut 1000 ppm
323.00 € 323.0 EUR
SENSISpec Spike Solution Milk 1000 ppm
323.00 € 323.0 EUR
SENSISpec Spike Solution Casein size: Allergen Spike Solutions size: Allergens
282.00 € 282.0 EUR
SENSISpec Spike Solution Almond
282.00 € 282.0 EUR
SENSISpec INgezim Hydrolyzed Gluten 48 wells
1,144.00 € 1144.0 EUR
SENSISpec INgezim Gluten R5 96 wells
914.00 € 914.0 EUR
SENSISpec ELISA Walnut 96 wells
750.00 € 750.0 EUR
SENSISpec ELISA Walnut 96 wells
750.00 € 750.0 EUR
SENSISpec ELISA Pecan nut 96 wells
750.00 € 750.0 EUR
SENSISpec ELISA Milk 96 wells
750.00 € 750.0 EUR
SENSISpec ELISA Macadamia nut 96 wells
750.00 € 750.0 EUR
SENSISpec ELISA Fish Parvalbumin 96 wells
750.00 € 750.0 EUR
SENSISpec ELISA Crustaceans Tropomyosin 96 Wells
1.00 € 1.0 EUR
SENSISpec ELISA Crustaceans Tropomyosin 96 wells
1,378.00 € 1378.0 EUR
SENSISpec ELISA Brazil nut 96 wells
750.00 € 750.0 EUR
SENSISpec ELISA Aflatoxin Total size: 96 wells
994.00 € 994.0 EUR
SENSISpec ELISA Aflatoxin B1
994.00 € 994.0 EUR
SENSIFAST SYBR NOsize:ROX ONEsize:STEP size: 500 Rxns
1,540.00 € 1540.0 EUR
SENSIColumn IAC Aflatoxin Total
700.00 € 700.0 EUR
SECRETED BIRAsize:FLAG, 2 ug
391.30 € 391.3 EUR
SEB Threat Detection Kit, 10/BX
600.00 € 600.0 EUR
SDSsize:Blue SDSsize:PAGE protein stain, ready to use size: 1 L
150.00 € 150.0 EUR
SDS – ULTRA PURE
550.00 € 550.0 EUR
SDFsize:1 alpha Recombinant Protein. 0.01mg
583.00 € 583.0 EUR
SDC1/CD138 Elisa kit: Horse Syndecansize:1/Cd138 ELISA Kit, 96 Tests
995.48 € 995.48 EUR
SDC1 elisa kit: Horse Syndecan 1 ELISA Kit size: 96 Tests
1,054.00 € 1054.0 EUR
SD Malaria Positive and Negative Controls
75.00 € 75.0 EUR
SD Bioline Syphilis
120.00 € 120.0 EUR
SD Bioline HCV duluent, acpp, lancets and swabs, 25 device
312.00 € 312.0 EUR
SD BIOLINE Strep A, 25 tests
155.00 € 155.0 EUR
SD BIOLINE Malaria Antigen P.F/PV size: 25 Tests
162.50 € 162.5 EUR
SD BIOLINE Malaria Antigen P.F HRP2/PLDH size: 25 Tests
0.00 € 0.0 EUR
SD BIOLINE HAV IGM 1Tx25/Kit
325.00 € 325.0 EUR
SD BIOLINE Chagas Ab Rapid size: 25 Tests/Kit
275.00 € 275.0 EUR
SCN1A 3'UTR Lentisize:reportersize:Luc Vector size: 1.0 μg
538.00 € 538.0 EUR
SCK6 Bacillus subtilis Strains 100ul
406.00 € 406.0 EUR
SCH 527123 size: 10mM in 1mL DMSO
255.00 € 255.0 EUR
SCD1 Antibody Primary Rabbit Polyclonal size: 200µL
565.00 € 565.0 EUR
SC5b9 elisa kit :: Human Soluble terminal complement complex SC5b9 ELISA Kitsize:96size:Stripsize:Wells
1,030.40 € 1030.4 EUR
SC5Bsize:9 Complex 100 µg
352.00 € 352.0 EUR
SB202190 FHPI size: 100 mg
286.00 € 286.0 EUR
SATB1 NM_002971 Human Recombinant Protein size: 20 µg
1,400.00 € 1400.0 EUR
SAT1 Elisa Kit :: Human SAT1 Spermidine/Spermine N1size:Acetyltransferase 1 ELISA Kit size: 96 Strip Wells
615.00 € 615.0 EUR
SARSsize:CoVsize:2 WT Pseudovirus, 1.0 mL 0.5mL X 2 vials
751.00 € 751.0 EUR
SARSsize:CoVsize:2 Spike WT Flucsize:GFP Pseudovirus size: 96 Tests
757.83 € 757.83 EUR
SARSsize:CoVsize:2 Spike Omicron Flucsize:GFP Pseudovirus size: 96 Tests
1,010.45 € 1010.45 EUR
SARSsize:CoVsize:2 Spike Delta Flucsize:GFP Pseudovirus size: 96 Tests
947.43 € 947.43 EUR
SARSsize:CoVsize:2 Specimen recombinant Stock 1 x 1.0mL
1,081.00 € 1081.0 EUR
SARSsize:CoVsize:2 Omicron XBB.1.5 Variant Pseudovirus, 1.0 mL 0.5mL X 2 vials
557.00 € 557.0 EUR
SARSsize:CoVsize:2 Flu/RSV Positive Control size: 6 x 0.5mL
469.00 € 469.0 EUR
SARSsize:CoVsize:2 COVIDsize:19 S1 protein, His Tag MALS verified size: 100 µg
706.00 € 706.0 EUR
SARSsize:CoVsize:2 COVIDsize:19 Nucleocapsid protein, His Tag size:200 ug
1,222.00 € 1222.0 EUR
SARSsize:CoVsize:2 COVIDsize:19 NSP6 Antibody, 0.1 mg
819.00 € 819.0 EUR
SARSsize:CoVsize:2 COVIDsize:19 NSP6 Antibody, 0.02 mg
495.00 € 495.0 EUR
SAPK/JNK Antibody
694.50 € 694.5 EUR
SAM1size:4 | Ssize:adenosylmethionine synthase
565.00 € 565.0 EUR
SAM elisa kit :: Mouse Ssize:Adenosylmethionine SAM ELISA Kit size: 96 Stripsize:Wells
740.00 € 740.0 EUR
SAM elisa kit :: Human Ssize:Adenosylmethionine ELISA Kit size: 96 Wells
729.00 € 729.0 EUR
SAA elisa kit :: Sheep Serum Amyloid A ELISA Kitsize:96size:Stripsize:Wells
907.00 € 907.0 EUR
SA4503 OOMC00073 , 5 mg
246.00 € 246.0 EUR
S9 Surfactant Pluracare 1307 size: 500 g
1,135.00 € 1135.0 EUR
S1pr1 elisa kit :: Mouse Sphingosine 1size:phosphate receptor 1 ELISA Kit size: 96size:Stripsize:Wells
925.00 € 925.0 EUR
S1P elisa kit :: Human S1P ELISA Kit, 96 T
776.00 € 776.0 EUR
S100B protein :: S100 Protein size: 0.1 mg
728.00 € 728.0 EUR
S.S Agar Salmonella Shigella Agar size: 500g
316.36 € 316.36 EUR
S. pneumoniae Stock Quantitative 1mL
900.55 € 900.55 EUR
S. pneumoniae Cell Wall Polysaccharide Antigen size: 10 mg
1,990.00 € 1990.0 EUR
Ssize:adenosylmethionine SAM GMPsize:grade 32 mM size: 0.5 mL
76.85 € 76.85 EUR
Ssize:Hook Cane Adapter Msize:UP1size:SH1size:HC35
417.00 € 417.0 EUR
Ssize:Adenosylmethionine SAM and Ssize:Adenosylhomocysteine SAH ELISA Combo Kit size: 96 assays
1,066.00 € 1066.0 EUR
Ssize:AdenosylMethionine SAM Elisa Kit Homogenate Samples, Broad Range size: 96 Tests
1,556.10 € 1556.1 EUR
Antibody
568.00 € 568.0 EUR
Ssize: Naringeninsize:7size:Osize:glucoside CAS N° 529size:55size:5 size: 10 mg
167.00 € 167.0 EUR
Rye Genomic DNA 0.1mg
578.00 € 578.0 EUR
Rye Agar B, 500G
336.00 € 336.0 EUR
Rye Agar A size: 500G
188.50 € 188.5 EUR
Rubella virus size: Real Time RNA, 100 test
1,457.30 € 1457.3 EUR
Rubella IgM ELISA Kit size: 96 wells plate
438.00 € 438.0 EUR
Rubella Elisa IgM Capture, 96 Tests
352.00 € 352.0 EUR
Rubella Elisa IgG, 96 Tests
302.00 € 302.0 EUR
Rubella Antigen HPVsize:77 Native Protein 1mg
2,589.00 € 2589.0 EUR
Round Snapsize:Lock Containers size:100Pk
84.99 € 84.99 EUR
Rotavirus typing Real Time RTsize:PCR Kit size: 25 tests
2,032.00 € 2032.0 EUR
Rosuvastatin size: 100 mg
320.00 € 320.0 EUR
Rosmantuzumab RSPO3 size: Research Grade Biosimilar size: 0.1 mg
784.50 € 784.5 EUR
Rosetta DE3 pLysS Escherichia coli Strains, 100 µL
474.50 € 474.5 EUR
Rosetta DE3 Escherichia coli Strains, 100 µL
406.00 € 406.0 EUR
Rose Bengal size: 125T
128.00 € 128.0 EUR
Roller base for HC35
575.00 € 575.0 EUR
Roche Covidsize:19 Antigen Nasal size: 25 Tests
87.00 € 87.0 EUR
Robustart Taq 5000 Units
1,140.00 € 1140.0 EUR
Rituximab, 1 MG
5,530.00 € 5530.0 EUR
Rituximab Antibody size: Research Grade – 50mg
1,803.00 € 1803.0 EUR
Rituximab size:SDSsize:PAGE>95%, Regular batch without endotoxin removal , 100 µg
2,830.00 € 2830.0 EUR
Ristocetin Cofactor Assay Kit size: 80 tests
900.00 € 900.0 EUR
Ripasudil HCl hydrate CAS No: 223645size:67size:8 size: 2 mg
203.00 € 203.0 EUR
Rifampicinsize:1 g
105.00 € 105.0 EUR
Rifampicin 13292size:46size:1 size: 1g
100.00 € 100.0 EUR
Rickettsia typhi IgG IFA Kit
1,093.00 € 1093.0 EUR
Rickettsia spp., 150 test
1,015.00 € 1015.0 EUR
Rickettsia rickettsii size: One Step PCR, 50 reactions
1,020.00 € 1020.0 EUR
Rickettsia conorii/typhi IgM MIF Kit
1,588.00 € 1588.0 EUR
Ricin, Abtrin C2T Multiplex
3,300.00 € 3300.0 EUR
Ricin Toxin Threat Detection Kit 10/BX
600.00 € 600.0 EUR
Ribosomal Protein S18 Polyclonal Antibody size: 50 µL
458.00 € 458.0 EUR
Ribosomal Protein S18 Polyclonal Antibody size: 20 µL
415.00 € 415.0 EUR
Ribosomal Protein S18 Polyclonal Antibody size: 100 µg
728.00 € 728.0 EUR
Ribosize:off rRNA depletion kit Plant size: 24 Reactions
972.00 € 972.0 EUR
Ribosize:off rRNA depletion kit Plant size: 12 Reactions
550.00 € 550.0 EUR
Ribosize:off rRNA Depletion Kit V2 Bacteria size: 24 Reactions
972.00 € 972.0 EUR
Ribosize:off rRNA Depletion Kit V2 Bacteria size: 12 Reactions
550.00 € 550.0 EUR
Ribosize:off Globin & rRNA Depletion Kit Human/Mouse/Rat size: 96 Reactions
3,975.00 € 3975.0 EUR
Ribosize:off Globin & rRNA Depletion Kit Human/Mouse/Rat size: 24 Reactions
1,123.00 € 1123.0 EUR
Ribosize:MagOff rRNA Depletion Kit Human/Mouse/Rat size: 24 Reactions
994.00 € 994.0 EUR
Ribosize:MagOff rRNA Depletion Kit Human/Mouse/Rat size: 12 Reactions
562.00 € 562.0 EUR
Ribbon size: White Ribbon 220mm
265.00 € 265.0 EUR
Ribbon size: Green Ribbon 220mm
265.00 € 265.0 EUR
Ribbon size: Black Ribbon 220mm
265.00 € 265.0 EUR
Rhodococcus equi RT PCR size:50 rxs
633.65 € 633.65 EUR
Rhodamine Phalloidin 14 µM in methanol
663.00 € 663.0 EUR
Rhodamine 123 chloride size:10mg
450.00 € 450.0 EUR
RhoA/Rac1/CDC42 Activation Assay Combo Kit size: 3 x 10 assays
1,320.00 € 1320.0 EUR
RhoA / Rac1 / Cdc42 Gsize:LISA Activation Assay Bundle 3 Kits 24 Assays Per Kit
2,667.00 € 2667.0 EUR
Rho/Rac/Cdc42 Activator I size: 9 x 20 µg
940.00 € 940.0 EUR
Rho activator II, 3 x 20 µg
545.00 € 545.0 EUR
Rho Kinase ROCK Activity Assay, 96size:Well
1,139.00 € 1139.0 EUR
Rheumatoid Factor Positive Serum , 1 ml
284.75 € 284.75 EUR
Rheumatoid Factor Positive Control Immunoglobulin size: 5ml
489.00 € 489.0 EUR
Rheumatoid Factor Positive Control Immunoglobulin size: 100 mL
1,426.00 € 1426.0 EUR
Rheumatoid Factor Control Serumsize: 1ml
553.65 € 553.65 EUR
Rheumatoid Factor Control Serum 1ml
379.00 € 379.0 EUR
Rheumatoid Factor Control Diluent, 100 ml
865.00 € 865.0 EUR
Rhabdomyosarcoma with striated muscle tissue array, including TNM and clinical stage, 104 cases/208 cores, replacing SO2082a, unstained, fresh cut, baked
665.00 € 665.0 EUR
RgpB polyclonal antibody, 100 µg
1,380.00 € 1380.0 EUR
Reusable B3 SSRL/SAM Style Goniometer Bases
333.00 € 333.0 EUR
Retrovirus iPSC Reprogramming Kit size: 1 Kit
1,600.00 € 1600.0 EUR
Retrovirus Concentration Solution 100 mL
455.00 € 455.0 EUR
Retrosize:Concentin Retroviral Concentration Reagen size: 100 ml
730.00 € 730.0 EUR
Reticulin Stain Kit without Gold Chloride size: 100 tests
239.00 € 239.0 EUR
Restriction endonuclease BstC8 I size: 2500 units
455.00 € 455.0 EUR
Respiratory swab matric neg control 10 vials
457.50 € 457.5 EUR
Respiratory Syncytial Virus RSV Rapid Test Control Pack 2 X 1.5mL
303.00 € 303.0 EUR
Respiratory Pathogen Panel size:1 6 x 0.25 mL
609.00 € 609.0 EUR
Respiratory Panel 2.1 RP2.1 Controls 12 x 0.3mL
621.75 € 621.75 EUR
Resmetirom CAS N° CAS 920509size:32size:6 size: 10 mg
216.00 € 216.0 EUR
Resiquimod size: 500µg
205.00 € 205.0 EUR
Residual SDS Detection Kit
136.00 € 136.0 EUR
Resazurin Cell Viability Assay Kit alamarBlue size: 25 mL
216.00 € 216.0 EUR
Replicationsize:competent Lentivirus RCL Detection Kit, 50T
1,439.00 € 1439.0 EUR
Replicationsize:competent Lentivirus RCL Detection Kit
2,229.00 € 2229.0 EUR
Replacement Prefilter Pack 1 Circulaire Laminar Flow Cabinet VLF1800
281.00 € 281.0 EUR
RepSox SJN 2511 size:25mg
268.00 € 268.0 EUR
Renin elisa kit :: Mouse Renin ELISA Kit
879.00 € 879.0 EUR
Renibacterium salmoninarum detection onesize:Step PCR kit size: 50 reactions
740.00 € 740.0 EUR
Renibacterium salmoninarum detection onesize:Step PCR kit size: 150 reactions
1,011.00 € 1011.0 EUR
Renibacterium salmoninarum detection onesize:Step PCR kit size: 100 reactions
770.00 € 770.0 EUR
Renibacterium salmoninarum detection Endsize:Point size: 96 reactions
590.00 € 590.0 EUR
Renibacterium salmoninarum detection Endsize:Point size: 48 reactions
465.00 € 465.0 EUR
Removal agent to prevent mycoplasma contamination size: 25 mg 10 x 1 ml
400.00 € 400.0 EUR
Removal agent to eliminate mycoplasmas size: 50 mg 2 x 1 ml
310.00 € 310.0 EUR
Removal agent to eliminate mycoplasmas size: 25 mg 1 x 1ml
400.00 € 400.0 EUR
Rely+On Virkon size: 5 kg
241.00 € 241.0 EUR
Relebactam size: 10 mg
466.00 € 466.0 EUR
Relebactam size: 10 mg
1,035.00 € 1035.0 EUR
Refill Glass Beads, 3mm, 1000g
117.00 € 117.0 EUR
RedDot™2 Farsize:Red Nuclear Stain, 200X in DMSO size: 25 µL
260.00 € 260.0 EUR
Red Blood Cells Animal Serum, 20 mL
605.00 € 605.0 EUR
Recombivirus Rabbit Antisize:Bovine Viral Diarrhea Virus 1size:3 BVDV1size:3 E2 Protein IgG ELISA kit, 96 tests, Quantitative
810.00 € 810.0 EUR
Recombivirus Mouse Theiler's murine encephalomyelitis virus TMEV/GDVII VP1 IgG ELISA Kit, 96 tests, Quantitative
695.00 € 695.0 EUR
Recombivirus Monkey Antisize:Zika Virus ZIKV NS1 protein IgG ELISA kit, 96 tests, Quantitative
1,040.00 € 1040.0 EUR
Recombivirus Monkey Antisize:Zika Virus ZIKV Envelop protein IgG Quantitative ELISA kit size: 96 wells plate
962.00 € 962.0 EUR
Recombivirus Human Antisize:Vaccinia virus VACV IMV/Envelop protein/H3L/p35 IgG ELISA kit, 96 tests, Quantitative
740.00 € 740.0 EUR
Recombinant parvovirus VP1 antigen size: 5mg
1,658.00 € 1658.0 EUR
Recombinant human IL10RA Protein, Fcsize:tagged, 500 UG 5X100 µg
6,288.00 € 6288.0 EUR
Recombinant human CEACAM4 protein, Hissize:tagged 1MG
5,049.00 € 5049.0 EUR
Recombinant antisize:CD19 x antisize:CD3 bispecific antibody Blinatumomab,100 µg
4,770.00 € 4770.0 EUR
Recombinant Varicellasize:zoster virus Envelope glycoprotein E gE size: 20 µg
1,300.00 € 1300.0 EUR
Recombinant Varicellasize:zoster virus Envelope glycoprotein E gE size: 100 µg
2,110.00 € 2110.0 EUR
Recombinant Thymine DNA Glycosylase TDG size: 50ug
360.00 € 360.0 EUR
Recombinant Symbiobacterium thermophilum DNA mismatch repair protein MutS mutS ,partialsize:LYOPHILISATEsize:1mg 5x200ug
1,924.00 € 1924.0 EUR
Recombinant Symbiobacterium thermophilum DNA mismatch repair protein MutS mutS ,partialsize:100ug
1,160.00 € 1160.0 EUR
Recombinant Streptavidinsize: 2x 5 mg, lyophilized
145.60 € 145.6 EUR
Recombinant Staphylococcus aureus Staphylococcal complement inhibitor scn 500ug
1,662.00 € 1662.0 EUR
Recombinant Staphylococcus aureus Staphylococcal complement inhibitor scn 200ug
933.00 € 933.0 EUR
Recombinant Staphylococcus aureus Staphylococcal complement inhibitor scn 1mg, Uniprot No. Q99SU9
2,959.00 € 2959.0 EUR
Recombinant Staphylococcus aureus Staphylococcal complement inhibitor scn 100 µg
602.00 € 602.0 EUR
Recombinant Staphylococcus aureus Serine Nsize:terminal 10xHissize:tagged and Csize:terminal Mycsize:tagged protease SplD splD
2,119.00 € 2119.0 EUR
Recombinant Staphylococcus aureus Exfoliative toxin A eta size:100 µg
890.00 € 890.0 EUR
Recombinant Schizosaccharomyces pombe Zincsize:type alcohol dehydrogenasesize:like protein C16A3.02c SPBC16A3.02c 1mg, Yeast
2,334.50 € 2334.5 EUR
Recombinant Schizosaccharomyces pombe Zincsize:type alcohol dehydrogenasesize:like protein C16A3.02c SPBC16A3.02c 100 µg, Yeast
1,166.00 € 1166.0 EUR
Recombinant Salmonella enterica I Flagellin fljB size:20ug
436.00 € 436.0 EUR
Recombinant Salmonella enterica I Flagellin fljB size:20ug
353.00 € 353.0 EUR
Recombinant Salmonella enterica I Flagellin fljB size:100 µg
489.00 € 489.0 EUR
Recombinant Salmonella enterica I Flagellin fljB
620.00 € 620.0 EUR
Recombinant Saccharomyces cerevisiae Mitochondrial import receptor subunit TOM70 TOM70 , partial
1.00 € 1.0 EUR
Recombinant Saccharomyces Cerevisiae RE
14,995.00 € 14995.0 EUR
Recombinant Saccharomyces Cerevisiae ATG16 Protein aa 1size:150 [His], 1 mg
4,600.00 € 4600.0 EUR
Recombinant SUDV GPdTM mammalian , HISsize:tag, 100 µg
752.00 € 752.0 EUR
Recombinant SARSsize:CoVsize:2 Ssize:trimer protein size: 0.1MG
479.00 € 479.0 EUR
Recombinant Rift Valley Fever Virus Glycoprotein aa 691size:1139 [His], 100 µg
1,401.00 € 1401.0 EUR
Recombinant Rhesus monkey TMEM27 full length or partial length protein was expressed, 100 µg
5,076.00 € 5076.0 EUR
Recombinant Rhesus Macaque HVEM Csize:6His , 500 ug
835.00 € 835.0 EUR
Recombinant Rat Ubiquitin carboxylsize:terminal hydrolase 19 Usp19 ,partial, Mammalian cell size: 100 µg
3,096.00 € 3096.0 EUR
Recombinant Protein A, thiol 50mg
1,125.00 € 1125.0 EUR
Recombinant Protein A, thiol size: 50mg
1,169.00 € 1169.0 EUR
Recombinant Plant NADH Nitrate Reductase AtNaR
285.00 € 285.0 EUR
Recombinant Mouse XEDAR/EDA2R Protein His Tag , 50ug
304.00 € 304.0 EUR
Recombinant Mouse XEDAR/EDA2R Protein His Tag , 10ug
200.40 € 200.4 EUR
Recombinant Mouse Tmem27 aa. Ile12~Leu222 fused with Nsize:terminal His & GST tag was produced in E. coli cells, 100 µg
718.00 € 718.0 EUR
Recombinant Mouse TIMsize:3/HAVCR2 Protein aa 20size:191, His Tag
485.60 € 485.6 EUR
Recombinant Mouse TGFBR2, hIgG1 Fcsize:tagged, 1mg
8,088.00 € 8088.0 EUR
Recombinant Mouse TGFBR2, hIgG1 Fcsize:tagged, 0.5mg
4,408.00 € 4408.0 EUR
Recombinant Mouse Semaphorinsize:4D/SEMA4D Protein Fc Tag , 50 ug
619.00 € 619.0 EUR
Recombinant Mouse Msize:CSF/CSF1 Protein His Tag size: 10ug
200.00 € 200.0 EUR
Recombinant Mouse Interleukinsize:12/ILsize:12 size: 10ug
460.00 € 460.0 EUR
Recombinant Mouse ILsize:34 protein His Tag , 100 µg
739.00 € 739.0 EUR
Recombinant Mouse GDF11/BMPsize:11 protein His tag size: 100µg
500.00 € 500.0 EUR
Recombinant Mouse Corticosteroid 11size:betasize:dehydrogenase isozyme 1 Hsd11b1 ,partial
1,200.00 € 1200.0 EUR
Recombinant Mouse Corin CRN ,50ug
798.00 € 798.0 EUR
Recombinant Mouse Cathepsin S Ctss size: 20ug
460.00 € 460.0 EUR
Recombinant Mouse Carboxylesterase 1C 0.1MG Ecoli
729.00 € 729.0 EUR
Recombinant Mouse Csize:C chemokine receptor type 8 Ccr8 size: 20 ug
1,793.00 € 1793.0 EUR
Recombinant Mouse Csize:C chemokine receptor type 8 Ccr8 size: 100 µg
2,766.00 € 2766.0 EUR
Recombinant Mouse Apolipoprotein E Apoe , 100 µg
578.00 € 578.0 EUR
Recombinant Mouse Apolipoprotein E Apoe 20ug
391.00 € 391.0 EUR
Recombinant Mouse Apolipoprotein E Apoe 1mg
2,466.00 € 2466.0 EUR
Recombinant Mouse Antisize:Monkey IgG Antibody clone TB109a , 1 MG
2,539.00 € 2539.0 EUR
Recombinant Mouse 11size:betasize:hydroxysteroid dehydrogenase 1 Hsd11b1 size: E.coli 100 µg
2,644.00 € 2644.0 EUR
Recombinant Malus domestica Nonsize:specific lipidsize:transfer protein MALD3 20ug
388.00 € 388.0 EUR
Recombinant Malus domestica Major allergen Mal d 1 MALD1 size:E.colisize:100 µg
840.00 € 840.0 EUR
Recombinant Malus domestica Major allergen Mal d 1 MALD1 20ug
388.00 € 388.0 EUR
Recombinant Malus domestica Major allergen Mal d 1 MALD1 size: MBS1224919 size: 0.02 mg Esize:Coli
648.00 € 648.0 EUR
Recombinant Malus domestica Apple Pyrus malus Nonsize:specific lipidsize:transfer protein size: MBS1327013 size: 0.02 mg Esize:Coli
648.00 € 648.0 EUR
Recombinant Macaca fascicularis CD93 molecule CD93 , 100 µg
557.00 € 557.0 EUR
• R0253C
0.00 € 0.0 EUR
• HiPurA® Blood Genomic DNA Miniprep Purification Kit size: 50 preps
275.00 € 275.0 EUR
• HiPer® Western Blotting Teaching Kit size: 50 preps
806.00 € 806.0 EUR
Еndothelial Cell Growth Supplement ECGS size: 500X
204.00 € 204.0 EUR
Доставка
0.00 € 0.0 EUR
ДДС 20%
0.00 € 0.0 EUR
ωsize:agatoxinsize:IVA, 0,5 mg
975.00 € 975.0 EUR
ωsize:Conotoxinsize:GVIA, 0.5 mg
449.00 € 449.0 EUR
δsize:1,2,3,4,5,6size:Hexachlorocyclohexane size: 1 g
7,700.00 € 7700.0 EUR
γsize:[Ethylsize:CONHsize: PEG4 ]size:ATPsize:Biotin size: 50ul
310.00 € 310.0 EUR
γsize:[ 8size:Aminooctyl size:imido]size:ATP size: 5 x 100ul
542.00 € 542.0 EUR
γsize:PEG8size:ATPsize:Biotin size: 50ul
310.00 € 310.0 EUR
γsize:Aminobutyric Acid GABA Colorimetric Assay Kit
430.00 € 430.0 EUR
γsize: 6size:Azidohexyl size:ATP 5 x 50 μl 10 mM
433.00 € 433.0 EUR
γsize: 6size:Aminohexyl size:ATPsize:Cy5 size: 160 ul
1,289.00 € 1289.0 EUR
γsize: 6size:Aminohexyl size:ATPsize:Biotin size: 50ul
388.00 € 388.0 EUR
γsize: 6size:Aminohexyl size:ATPsize:ATTOsize:647N size: 120 µL
1,195.00 € 1195.0 EUR
γsize: 2size:Azidoethyl size:ATP 5 x 100 μl 10 mM
433.56 € 433.56 EUR
βsize:Hexosaminidase Activity Assay size: 100 Tests
450.00 € 450.0 EUR
βsize:HCG size: 96 Tests/box
62.00 € 62.0 EUR
βsize:Glucan Assay Kit Mixed Linkage size: 100 assays
600.00 € 600.0 EUR
βsize:Galactosidase from Escherichia coli size: 1000 units
246.00 € 246.0 EUR
βsize:Galactosidase Staining Kit size: 1 kit
582.00 € 582.0 EUR
βsize:Casomorphin bovine size: 5mg
420.00 € 420.0 EUR
βsize:Amyloid 1size:42 , rat/mouse TFA , 10 mg
1,429.00 € 1429.0 EUR
αsize:MEM with Lsize:Gln, Ribonucleosides and Deoxyribonucleosides, liquid size: 500 mL
221.50 € 221.5 EUR
αsize:Bungarotoxin, CF® Dye and Other Conjugates CF488A, 0.5mg
749.00 € 749.0 EUR
αsize:Amylase Activity Assay Kit size: 96T
375.00 € 375.0 EUR
αsize:Amylase Activity Assay size: 100 Assays
430.00 € 430.0 EUR
°BMPS CAS N°55750size:62size:4 size: 100 mG
153.00 € 153.0 EUR
ylated Human FcRn / FCGRT&B2M Heterodimer Protein, His,Avitag MALS & SPR verified size: 200ug
1,800.00 € 1800.0 EUR
xylA recombinant protein :: Xylose isomerase xylA Recombinant Protein size: 1 mg Esize:Coli
2,600.00 € 2600.0 EUR
watersafe WS425B
40.00 € 40.0 EUR
van eyck
1.00 € 1.0 EUR
v
1.00 € 1.0 EUR
transport gratis
0.00 € 0.0 EUR
transsize:ISRIB, 10 mg
339.00 € 339.0 EUR
total collagen assay kit 2x 96size:assays
820.00 € 820.0 EUR
tissuesize:tek Xpress X120 Processing Reagent Set size: 4 x 3.8 L
1,123.00 € 1123.0 EUR
tdTomato Goat Polyclonal Antibody, 600 µg
442.00 € 442.0 EUR
tTG recombinant protein size: 5x1 mg
5,523.00 € 5523.0 EUR
tTG recombinant protein size: 1 mg
1,279.00 € 1279.0 EUR
tTG recombinant protein size: 0.1 mg
463.00 € 463.0 EUR
tDenHybsize:2 For tissue FISH with unique sequence probes size: 1mL
388.41 € 388.41 EUR
tDenHybsize:1 For general tissue FISH size: 1 mL
279.00 € 279.0 EUR
synomag®size:D streptavidin, 70 nm, 5 mg/ml size: 2 ml
473.00 € 473.0 EUR
synomag®size:D streptavidin, 50 nm, 5 mg/ml size: 2ml
473.00 € 473.0 EUR
sulfo Cyanine5 azide size: 1 mg
191.00 € 191.0 EUR
stomer service:Sequence , MEKLSEQELAKVSGGFPLLPIVVPIIAGGATYVAKDAWNHLDQIRSGWRKAGNSKW, 90% purity, 3 MG
926.00 € 926.0 EUR
sspB recombinant protein :: Stringent starvation protein B sspB Recombinant Protein Esize:Coli size: 1 mg
1,980.00 € 1980.0 EUR
soluble epoxide hydrolase: ~100 U/mg size: 50 µg
2,200.00 € 2200.0 EUR
shp53 pLKO.1 puro Plasmid, 2 ug
335.40 € 335.4 EUR
shipping
0.00 € 0.0 EUR
sRAGE elisa kit :: Rat sRAGE Solube Receptor for Advanced Glycation End product ELISA Kit size: 96size:Stripsize:Wells
1,210.00 € 1210.0 EUR
sPsize:Sel elisa kit :: Bovine soluble Psize:selectin sPsize:Sel ELISA Kit, 96 tests
706.00 € 706.0 EUR
sICAMsize:1 elisa kit :: Guinea Pig sICAMsize:1 ELISA Kitsize:96size:Stripsize:Wells
810.00 € 810.0 EUR
sAPPbsize:Wild Type high sensitive ELISA
1,444.30 € 1444.3 EUR
sAPPa high sensitive ELISA
1,444.30 € 1444.3 EUR